.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mcp_N and cache N-terminal domains of methyl-accepting chemotaxis protein from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 3c8c Target Id NYSGXRC-10228a
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8007,PF05581, Q9KL26 Molecular Weight 70286.51 Da.
    Residues 652 Isoelectric Point 4.64
    Sequence visnwlkcqnitinlliiitlslwkgitmkfshkivaassvlllatvallsgsqyfkvrdeirsmvsds vdeivdgvskttaevingrksiaqyatsliennpepdnvrtiisqplikntfllvgfglekdgsninnd pswnpgptwdprvrpwykdaknagklvitapyadsasgeilvsvatpvkdsatgqflgsifydvslael aelvnevklfdagyvfivsedgttiahpkkefngkpmseflgeskinvdthqviingkpyavsfsdveg edwyvgvvideeiayaaldelrrstliftvialvisvfvllfivrvlmkpldtlndaiqnvasgegdlt qrlstntdeefaklaigfntftetlqkqliqskaigaeilrgsestsmtlqqsaeamrsqlheleqlat amhemattssdvannaqgaasaakvaddaaaagtdvvtkttkaidtlsatidaavddvkvlesatanie tvlkvindiadqtnllalnaaieaaragesgrgfavvadevrtlaqrtqqstteirnmieklqsganav avamshskdtaasavnqaqganealekirlaiqqisdmniqiasaaeeqslvaeeinnntvkikdlsdq vaesadeanmsmqiqtenireqdailnkfkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.23452
    Matthews' coefficent 2.22 Rfactor 0.19372
    Waters 653 Solvent Content 44.58

    Ligand Information
    Ligands ALA x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3c8c
    1. Sensor domains of two-component regulatory systems
    J Cheung, WA Hendrickson - Current opinion in microbiology, 2010 - Elsevier
     
    2. Structural analysis of ligand stimulation of the histidine kinase NarX
    J Cheung, WA Hendrickson - Structure, 2009 - Elsevier
     
    3. Structural characterization of the predominant family of histidine kinase sensor domains
    Z Zhang, WA Hendrickson - Journal of molecular biology, 2010 - Elsevier
     
    4. Sensing of environmental signals: classification of chemoreceptors according to the size of their ligand binding regions
    J Lacal, C Garca_Fontana - Environmental , 2010 - Wiley Online Library
     
    5. A Bacillus subtilis sensor kinase involved in triggering biofilm formation on the roots of tomato plants
    Y Chen, S Cao, Y Chai, J Clardy, R Kolter - Molecular , 2012 - Wiley Online Library
     
    6. Mlp24 (McpX) of Vibrio cholerae implicated in pathogenicity functions as a chemoreceptor for multiple amino acids
    S Nishiyama, D Suzuki, Y Itoh, K Suzuki - Infection and , 2012 - Am Soc Microbiol
     

    Protein Summary


    The 3c8c alanine-bound structure is of the soluble periplasmic receptor domain of methyl-accepting chemotaxis protein. The successful construct was slightly shorter at the N-terminus (63-300 vs 54-300) and lacked a C-terminal His tag and yielded a structure to 1.5 Angstroms. All residues are visible including the Ser-Leu cloning artifact at the N-terminus. The N- and C-terminus are quite close, as expected, since both ends are anchored in the membrane. The full length protein has a C-terminal domain (330-652) on the other side of the membrane that contains methylation sites (not part of this structure).

       

        

       


    Ligand Summary

    Alanine is a natural substrate and is tightly bound in a pocket.
    Magnesium is coordinated in each monomer, but by different residues in each case.

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch