.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fumarate lyase from Mesorhizobium sp. BNC1. To be Published
    Site NYSGXRC
    PDB Id 3c8t Target Id NYSGXRC-9456l
    Molecular Characteristics
    Source Mesorhizobium sp. bnc1
    Alias Ids TPS7846,PF00206, 110635948 Molecular Weight 49744.26 Da.
    Residues 456 Isoelectric Point 5.99
    Sequence mrismatffpqsvtaldsplygrsfaddkmrelfsaqsfisrcvetevalaraqarlgiipedaaagit aaartfapemerlrddteivgypilplveqlsahageagkylhwgattqdimdtatvlqirdglalisr riesvrkalaalarnhrdtpmagrthlqhalpvtfgykaavwlsafdrhaarleeisprvlvvefsgas gtlaslgtrgldvqrelarelnlgvpsitwhsardavaetvqflalvsgslgklamdisimmttelgev aepfvrhrgasstmpqkqnpvscelilagarivrnhatsmldamihdferatgpwhlewsavpegfava sgilyqaefmlgglqvfpdrmrenldhsrglivaeavmmalaphtgrkeahdivylgcrravedktglf evlrtmpevakplgeealrdltdprnylgsagamvdnvlggr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.262
    Matthews' coefficent 2.16 Rfactor 0.201
    Waters 178 Solvent Content 43.06

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch