.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c97

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from Aspergillus oryzae. To be Published
    Site NYSGXRC
    PDB Id 3c97 Target Id NYSGXRC-11018t
    Molecular Characteristics
    Source Aspergillus oryzae
    Alias Ids TPS7883,3.40.50.2300, Q2U940_ASPOR, PF00072 Molecular Weight 76077.62 Da.
    Residues 693 Isoelectric Point 5.71
    Sequence mggsrlfvckkqtqplvqsrkvsadtpngiqiaicdvpngyvqevppkeypvtewrddtantsckfdkd laelprsldlyepfrsgteveqipgrqidaeaidaskgdpiteahyfpkppnvasshgfekhisvrtfd eiiklknsirhmtsivekrlehcisaretveeayhsksellatmsheirtpihgiigmaqlgleagclp avahdafnlvhslgksllaninnvldlsrieasrmviesipfnlgstvlstlkplaveaskkmtdltye vgshvpqhaigdpnrlcqilfnlvgnavkftnngrielsvktaqqqacaknqcvlefsvadtgvgippn klelifdrfqqaddsvmkqfggtglglaisrklvslmggdiwvrstvgkgsifsftcplklespcattt eqkkshrdlvifyitangqksdpickiitglgiqvrvfnqhdiqiqelrdqnhlpdaliveslemacal rahghfgstplvlfdptpsdslkisirsafdlgivsyitspcssesvlssllsalqdrprhlepsqimp lsvliaedndicrlvaakalekctnditvvtnglqalqayqnrqfdviimdiqmpvmdgleavseirny erthntkrasiiaitadtidddrpgaeldeyvskplnpnqlrdvvltchsegaksptigdnmdrgsaceisr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.271
    Matthews' coefficent 1.99 Rfactor 0.246
    Waters 20 Solvent Content 38.07

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c97
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch