.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 5'-nucleotidase from Candida albicans. To be Published
    Site NYSGXRC
    PDB Id 3c9f Target Id NYSGXRC-9006a
    Molecular Characteristics
    Source Candida albicans
    Alias Ids TPS7927,XP_717145.1, PF00149 Molecular Weight 64790.06 Da.
    Residues 562 Isoelectric Point 6.20
    Sequence mllilavvlfsgcyasfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthlrriahsr nqdlllidsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfqdky vcsnvdirldnglfvplglkykyfttpirgirvlafgflfdfkrfnsgtrvtpmaetihepwfqealkh evdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdftvfdslstglqsgrycetvgw tsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldkefdtakgklvskliretrkelkldtligyvk tnyyvdyvpidhpksifnllalkilktlpkskheeritiintgsirydlykgpytidskfivspfeniw vnitvpksvatkvaaklndadyisasrlkpphqydlqvqdlstsphqahfemqeklpkgyvthddfgad gddtlhravvnfpvpnviqsveindevdspvnlvfysfitpniiwalkelnfsteqvptpysdiylgtl lnefvannki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.22524
    Matthews' coefficent 3.24 Rfactor 0.1864
    Waters 835 Solvent Content 62.04

    Ligand Information
    Ligands FMT (FORMIC) x 2
    Metals ZN (ZINC) x 2;NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 3c9f
    1. Cellular function and molecular structure of ecto-nucleotidases
    H Zimmermann, M Zebisch, N Strter - Purinergic signalling, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch