.
The Open Protein Structure Annotation Network
PDB Keyword
.

3caw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of o-succinylbenzoate synthase from Bdellovibrio bacteriovorus liganded with Mg. To be Published
    Site NYSGXRC
    PDB Id 3caw Target Id NYSGXRC-9462a
    Molecular Characteristics
    Source Bdellovibrio bacteriovorus
    Alias Ids TPS7847,NP_967527, PF01188 Molecular Weight 37399.36 Da.
    Residues 330 Isoelectric Point 7.72
    Sequence mikisyspytlkpvqslnaataataregvllkvewndglygfadlhpwpelgdlsleeqlsdlrmgrmt tqieqsiwlarrdallrkekkhvfdggekiknnyllshfqdlkpgfldglknegyntvkvkmgrdlqke admlthiaasgmrmrldfnalgswqtfekfmvnlpltvrplieyvedpfpfdfhawgearklakialdn qydkvpwgkiasapfdvivikpaktdvdkavaqcqkwnlklavtsymdhpvgvvhavgvamelkdkygd milesgclthrlyqmdsfaaelstqgpyllknkgtgvgfdkllealtwyqlkvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.244
    Matthews' coefficent 2.20 Rfactor 0.218
    Waters 242 Solvent Content 44.01

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3caw
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch