The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of L-Talarate dehydratase from Polaromonas sp. JS666 complexed with Mg and L-glucarate. To be Published
    Site NYSGXRC
    PDB Id 3cb3 Target Id NYSGXRC-9382a
    Related PDB Ids 2og9 
    Molecular Characteristics
    Source Polaromonas sp. js666
    Alias Ids TPS7833,PF02746 Molecular Weight 41721.45 Da.
    Residues 383 Isoelectric Point 6.36
    Sequence mktttsstpsdritwvrisscylplatpisdakvltgrqkpmteiailfaeietagghqglgfsyskra ggpgqfahareiapaligedpsdiaklwdklcwagasagrsglstqaigafdvalwdlkakraglslak llgsyrdsvrcyntsggflhtpidqlmvnasasiergiggiklkvgqpdgaldiarvtavrkhlgdavp lmvdanqqwdrptaqrmcrifepfnlvwieepldaydheghaalalqfdtpiatgemltsaaehgdlir hraadylmpdaprvggitpflkiaslaehaglmlaphfamelhvhlaaayprepwvehfewleplfner ieirdgrmlvptrpglgltlsgqvkawtreeaqvgtrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.30 Rfactor 0.210
    Waters 500 Solvent Content 46.58

    Ligand Information
    Ligands LGT (L-GLUCARIC) x 4
    Metals MG (MAGNESIUM) x 8



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch