The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved protein (MTH639) from Methanobacterium thermoautotrophicum. To be Published
    Site NYSGXRC
    PDB Id 3cbn Target Id NYSGXRC-10241d
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS8008,O26735_METTH, DUF371 Molecular Weight 18148.61 Da.
    Residues 161 Isoelectric Point 5.24
    Sequence lpvelfflgpaetqffhgdpmgvlrytlrarghpnvtaghrttfevtvdpeigetadciigvsssdsis tlpdemkraiaresslvrvilrtengydeirgyghpeltldhptdivcrksdyicsrtlmiradkaafd ldenlvrdlrkgrelkveiivey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.244
    Matthews' coefficent 1.72 Rfactor 0.213
    Waters 126 Solvent Content 28.30

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch