.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cbw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YdhT protein from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 3cbw Target Id NYSGXRC-11098a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7901,3.20.20.80, CAB12407.1 Molecular Weight 40813.70 Da.
    Residues 362 Isoelectric Point 5.69
    Sequence lfkkhtislliifllasavlakpieahtvspvnpnaqqttktvmnwlahlpnrtenrvlsgafggyshd tfsmaeadrirsatgqspaiygcdyargwletaniedsidvscngdlmsywknggipqislhlanpafq sghfktpitndqyknildsataegkrlnamlskiadglqelenqgvpvlfrplhemngewfwwgltsyn qkdnerislykqlykkiyhymtdtrgldhliwvyspdanrdfktdfypgasyvdivgldayfqdaysin gydqltalnkpfaftevgpqtangsfdyslfinaikqkypktiyflawndewsaavnkgasalyhdswt lnkgeiwngdsltpive
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.27 Rfree 0.172
    Matthews' coefficent 1.82 Rfactor 0.149
    Waters 592 Solvent Content 32.39

    Ligand Information
    Ligands CIT (CITRIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 3cbw
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Understanding how diverse _-mannanases recognize heterogeneous substrates
    LE Tailford, VMA Ducros, JE Flint, SM Roberts - Biochemistry, 2009 - ACS Publications
     
    3. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch