.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cdx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of succinylglutamatedesuccinylase/aspartoacylase from Rhodobacter sphaeroides. To be Published
    Site NYSGXRC
    PDB Id 3cdx Target Id NYSGXRC-9277m
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS7802,125654652, PF00246 Molecular Weight 37420.15 Da.
    Residues 346 Isoelectric Point 5.48
    Sequence manseaksriacdidfdrdgrqagyaraplsrnnsgwgtveipitvvkngsgptvlltggvhgdeyegq iaisdlarrlrpeevqgrvimlpavnmpaiqsdtrlspvdgrdinrcfpgdprgtfsqmlahfldsvil pmadisvdmhtaghsydstpstnmhyladpalrartlaaaeafgaphnvvfggvdegstftscverrgi vslgtelggwgrvniegvrigkrgilnvlkhmgviegtpetaqrggaagtrhmmvreadayvmaprtgl fepthyvgeevrtgetagwihfvedvdtaplellyrrdgivwfgagpgrvtrgdavavvmedyndtwpqh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.244
    Matthews' coefficent 2.23 Rfactor 0.181
    Waters 1256 Solvent Content 44.83

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 3cdx
    1. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch