.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ce2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative peptidase from Chlamydophila abortus. To be Published
    Site NYSGXRC
    PDB Id 3ce2 Target Id NYSGXRC-10379t
    Molecular Characteristics
    Source Chlamydophila abortus
    Alias Ids TPS8023,BIG_190, Q5L5N2_CHLAB Molecular Weight 69539.94 Da.
    Residues 608 Isoelectric Point 5.91
    Sequence msvefnkqqvrprseispqdcwditplylnrkawkadldsfglktdgsptwpalqatqyqldnseslls llttlfsierklnklyvyahlthdqditnqegiadlksithlhtlfaeetswvqpaltslsesliaqhl sapclapyrfylekifrlsihtgtpgeekilasaftplevaskafsslsdseipfgqatdsegnshpls halaslymqstdrelrktsylaqceryhsyrhtfanllngkiqahvfyaknkrynsclqaalyhnnipt tvytnlidivkknsslitkyfsikqrclnlkdfhfydvyaplsqskekkytfqeavdliytslsplgte yidtlkqglttqgwvdkyenlnkrsgayssgcydshpyvllnytgtlydvsviahegghsmhsyfsrkh qpfhdaqypiflaeiastlnemllmdsmlkesdskeekitiltrcldtifstlfrqvlfasfeydihha aehgvplteeylsstyknlqnefygeiitfdvlsniewariphfyynfyvyqyatgiiaalcflekiln nednalnsylnflksggsdfpleilkksgldmgtvepiqkafcfiekkiqelssli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.246
    Matthews' coefficent 3.20 Rfactor 0.192
    Waters 19 Solvent Content 61.52

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 3ce2
    1. The molecular analysis of Trypanosoma cruzi metallocarboxypeptidase 1 provides insight into fold and substrate specificity
    G Niemirowicz, D Fernndez, M Sol - Molecular , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch