.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cfy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Signal Receiver Domain of Putative Luxo Repressor Protein from Vibrio Parahaemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3cfy Target Id NYSGXRC-11019x
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS7885,3.40.50.2300, Q87PN2_VIBPA, PF00072 Molecular Weight 57373.17 Da.
    Residues 514 Isoelectric Point 5.58
    Sequence mrprvllvedstslailykqyvkdepydifhvetgrdaiqfierskpqliildlklpdmsgedvldwin qndiptsviiatahgsvdlavnliqkgaedflekpinadrlktsvalhlkrakledlveniqstfdrhn yhgfigsslpmqavyktidavaptsasvfivgesgtgkevcaeavhrqsdrrdkpfiaincgaiprdlm eseifghvkgaftgattdrkgaatlahggtlfldelcemelemqktllrflqtgtytplggtkemkvdv riicatnrdplteveegrfredlyyrvhvvpidmpplrergsdivtlakhflttyakedkkkfsnidte aqhvikhyewpgnvrqlqniirnivvlnndekvtvahlpaqltqkktqartvtpvhvessspsnnlngh napamqtppiepvqpvqeapaqqtqptvgvetpshslspyfnadgsirpmwqvereaiqnaiaycdgnv lnaavmlelspstvyrkkqaweadevnleqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2907
    Matthews' coefficent 2.62 Rfactor 0.24645
    Waters 18 Solvent Content 53.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cfy
    1. Comparative structural analysis of two proteins belonging to quorum sensing system in Vibrio cholerae
    MHUT Fazil, S Kumar, NS Rao, C Selvaraj - Journal of , 2012 - Taylor & Francis
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch