.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cg0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Signal Receiver Domain of Modulated Diguanylate Cyclase from Desulfovibrio desulfuricans. To be Published
    Site NYSGXRC
    PDB Id 3cg0 Target Id NYSGXRC-11022g
    Molecular Characteristics
    Source Desulfovibrio desulfuricans
    Alias Ids TPS7889,Q311G8_DESDG, 3.40.50.2300, PF00072 Molecular Weight 61070.55 Da.
    Residues 561 Isoelectric Point 5.54
    Sequence mtasddlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcgaldgv etaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaihkkkleqrllesea ryrliveslndglaildagyhirycntklvamlqntgavalhapftsllhpgsvsrflltaqsaatsgf asfggnlqavddvalpvrvgvscrkaegnrqseyvcvltdvselvasaaaqreaeakyrtifenahegi fqaradgrflevnpsmaalfgfpdaatmlhevpslcalfatgaeqgehclpflasqesvhgfqlqlmtr kgdtvwvelschtvldaagnvnrlegmiidvterrkhelhllrlatkddltgvsnraafrdmlkksvee vkessicsallyidlnyfkkvndkyghyvgdmvlrevaarlssrvrtadvigrvggdefcvllrgvggv eravslaedmrgvldkpfenlpeehrlgmsigvlllqppdvvdageamrradsamyhakttgrgvvvwe egmlqskac
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.28842
    Matthews' coefficent 2.34 Rfactor 0.23162
    Waters 91 Solvent Content 47.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cg0
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     
    2. The subunit interfaces of weakly associated homodimeric proteins
    S Dey, A Pal, P Chakrabarti, J Janin - Journal of molecular biology, 2010 - Elsevier
     
    3. Fold space unlimited
    MJ Sippl - Current opinion in structural biology, 2009 - Elsevier
     
    4. Three_dimensional domain swapping in the protein structure space
    Y Huang, H Cao, Z Liu - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch