.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cih

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3cih Target Id NYSGXRC-12028b
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS7766,PF05592, NP_809914.1 Molecular Weight 83915.97 Da.
    Residues 729 Isoelectric Point 5.34
    Sequence millgalslasstfaqtwiwypgdyeiwlgnqmnnrrtergaffppfwktdshyvvvefskvlnlsepe evfiaaegtynvkldgklqfgmpetlllpagkhslnikvwnqatpptiyvkgktvnsdsswrvtyedke widesgkasdtsatiymdagcwnfdgatqrpsqfslmrepqqpvakteqpeggilydfgketfgfitlk nlsgkgkidlyygespeeakdkaycetldklllepgqitdlairstsplhhsdneytlenskafryvyi thepevqigevsmqyeylpeeyrgnfrcndeelnciwevgaytmhlttreffidgikrdrwvwsgdaiq sylmnyylffdsesvkrtiwllrgkdpvtshsntimdytfywflsvydyymysgdrhfvnqlyprmqtm mdyvlgrtnkngmvegmsgdwvfvdwadgyldkkgelsfeqvlfcrsletmalcadlvgdkdgqqkyek lasalkakleptfwnnqkqafvhncvdgrqsdavtryanmfsvffdylnadkqqaikqsvllndeilki ttpymrfyelealcalgeqetvmkemkaywggmlkagatsfwekynpeesgtqhlamygrpygkslcha wgaspiyllgkyylgvkptkegykefavspvlgglkwmegtvptpngdihvymdnktikvkategkgyl tiqsrrqpkanmgtvekvsegvwrlwidspeerivtyrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.33 Rfree 0.233
    Matthews' coefficent 3.10 Rfactor 0.203
    Waters 384 Solvent Content 60.37

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;EDO (1,2-ETHANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3cih
    1. Functional metagenomics unveils a multifunctional glycosyl hydrolase from the family 43 catalysing the breakdown of plant polymers in the calf rumen
    M Ferrer, A Ghazi, A Beloqui, JM Vieites - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch