.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cjp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized amidohydrolase CAC3332 from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 3cjp Target Id NYSGXRC-9321a
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS7821,15896580, PF04909 Molecular Weight 29057.23 Da.
    Residues 262 Isoelectric Point 6.08
    Sequence miidghthvilpvekhikimdeagvdktilfstsihpetavnlrdvkkemkklndvvngktnsmidvrr nsikeltnviqaypsryvgfgnvpvglsendtnsyieenivnnklvgigeltpasgqikslkpifkysm dsgslpiwihafnplvlqdikeiaelckafpkvpvilghmggsnwmtavelakeiqnlyldtsayfstf vlkivinelplkcifgtdmpfgdlqlsieaikkmsndsyvanavlgdnisrllni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.241
    Matthews' coefficent 2.19 Rfactor 0.184
    Waters 343 Solvent Content 43.93

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3cjp
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch