.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ck5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a racemase from Streptomyces coelicolor A3(2) with bound magnesium. To be Published
    Site NYSGXRC
    PDB Id 3ck5 Target Id NYSGXRC-9301a
    Related PDB Ids 2ovl 
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS7814,PF01188, 21221904 Molecular Weight 39376.74 Da.
    Residues 361 Isoelectric Point 5.78
    Sequence miervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavatmvdkdlrgc llgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartplwklfggydpvvpvyagg idlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlgdsfplmvdanmkwtvdgair aaralapfdlhwieeptipddlvgnarivresghtiaggenlhtlydfhnavragsltlpepdvsnigg yttfrkvaalaeannmlltshgvhdltvhalasvphrtymeahgfglhaymaepmavtdgcvsapdrpg hgvvldferlgrlavg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.68 Rfactor 0.224
    Waters 336 Solvent Content 54.11

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3ck5
    1. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch