.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ckw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sterile 20-like kinase 3 (MST3, STK24). To be Published
    Site NYSGXRC
    PDB Id 3ckw Target Id NYSGXRC-5632a
    Related PDB Ids 3ckx 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8055,PF00069, NP_003567.2 Molecular Weight 47938.81 Da.
    Residues 431 Isoelectric Point 5.28
    Sequence mahspvqsglpgmqnlkadpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiediqq eitvlsqcdspyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilreilkgldylhse kkihrdikaanvllsehgevkladfgvagqltdtqikrntfvgtpfwmapevikqsaydskadiwslgi taielargepphselhpmkvlflipknnpptlegnyskplkefveaclnkepsfrptakellkhkfilr nakktsyltelidrykrwkaeqshddsssedsdaetdgqasggsdsgdwiftirekdpknlengalqps dldrnkmkdipkrpfsqclstiisplfaelkeksqacggnlgsieelrgaiylaeevcpgisdtmvaql vqrlqryslsgggtssh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.96 Rfree 0.265
    Matthews' coefficent 2.20 Rfactor 0.207
    Waters 271 Solvent Content 43.98

    Ligand Information
    Ligands
    Metals HG (MERCURY) x 2

    Jmol

     
    Google Scholar output for 3ckw
    1. Structures of human MST3 kinase in complex with adenine, ADP and Mn2+
    TP Ko, WY Jeng, CI Liu, MD Lai, CL Wu - Section D: Biological , 2010 - scripts.iucr.org
     
    2. QM/MM refinement and analysis of protein bound retinoic acid
    X Li, Z Fu, KM Merz Jr - Journal of Computational Chemistry, 2012 - Wiley Online Library
     
    3. Analysis of conditions affecting auto-phosphorylation of human kinases during expression in bacteria
    A Shrestha, G Hamilton, E O'Neill, S Knapp - Protein expression and , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch