.
The Open Protein Structure Annotation Network
PDB Keyword
.

3clk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcription regulator from lactobacillus plantarum. To be Published
    Site NYSGXRC
    PDB Id 3clk Target Id NYSGXRC-11017j
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS7880,3.40.50.2300, Q88S23_LACPL, PF00532 Molecular Weight 36628.74 Da.
    Residues 335 Isoelectric Point 7.69
    Sequence msvtikdiarkvgvapstvsrvlsnkskyytsetaemvrkaarelgykknqaavelvkkssnviaavvs svrtnfaqqildgiqeeahkngynliivysgsadpeeqkhalltaierpvmgilllsialtddnlqllq ssdvpycflsmgfdddrpfissddedigyqatnllineghrqigiagidqypytgrkrlagykkalkea niainqewikpgdysytsgeqamkafgkntdltgiiaasdmtaigilnqassfgievpkdlsivsidgt emckitrpqltsisqdffqmgvtgvqqihqsvkngsnrivsqqfipvnpvirkstarlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.08 Rfree 0.286
    Matthews' coefficent 2.11 Rfactor 0.24
    Waters 190 Solvent Content 41.69

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3clk
    1. MODELAGEM MOLECULAR NO ENSINO DE QUMICA FARMACUTICA
    CH Andrade, GHG Trossini, EI Ferreira - Revista Eletrnica de , 2010 - revistas.ufg.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch