.
The Open Protein Structure Annotation Network
PDB Keyword
.

3clw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved exported protein from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 3clw Target Id NYSGXRC-11098o
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS7903,3.20.20.80, CAH07216.1 Molecular Weight 59556.52 Da.
    Residues 522 Isoelectric Point 6.21
    Sequence lytmrkisiliaaltlsislkplaaqnkkvfiidkqtvyqeidnfsasdawrcafigknwpqekkekia dllfkrefdekgnpigmaltnwrvnigagsyenreakevdnswnrtecflspdgkydftkqagqqwfmk aarergmnnflfftnsapyfmtrsastvstdqdcinlqndkfddfarflvksaqhfreqgfhvnyispn nepngqwhansfqegsfatkadlyrmveeldkaiseaqidtkilipevgdmkylfeidsiaktpddiih smfykdgqysvlkfknlfncvaahdywsaypatllvdirnrihkelsanghntkfwaseycilekneei tmpaspersinlglyvariihndltlanasawqwwtavslgedvpiqllplegsnglslqydgeisttk mlwttanysffvrpgmkriaikptykisdleaatslmissytdgkevvtvainyskenqvislncdhaq kgkvylttidknlrymgeqplkklqlparsvativvedn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.243
    Matthews' coefficent 2.87 Rfactor 0.199
    Waters 944 Solvent Content 57.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3clw
    1. Consolidation of glycosyl hydrolase family 30: A dual domain 4/7 hydrolase family consisting of two structurally distinct groups
    FJ St John, JM Gonzlez, E Pozharski - FEBS letters, 2010 - Elsevier
     
    2. Structural and Functional Analyses of a Glycoside Hydrolase Family 5 Enzyme with an Unexpected -Fucosidase Activity
    S Yoshida, DS Park, B Bae, RI Mackie, IKO Cann - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch