.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative beta-galactosidase from Bacteroides fragilis. To be published
    Site NYSGXRC
    PDB Id 3cmg Target Id NYSGXRC-11098l
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS7902,3.20.20.80, CAH06099.1 Molecular Weight 79904.64 Da.
    Residues 695 Isoelectric Point 7.64
    Sequence mkqqkcnyfpslwwrgrekglstflflllfsislhaqrqdillnnnwnfrfshqvqgdtrrvdlphtwn aqdalagkidykrgignyekalyirpewkgkrlflrfdgvnsiadvfinrkhigehrggygafifeitd lvkygeknsvlvranngeqldimplvgdfnfyggiyrdvhllitdetcispldyaspgvylvqevvspq eakvcakvnlsnraadgtaelqvlvtdgtkvickesrnvslkqgadileqlplliqkprlwngcedpfm yqvsislhkdgkqidsvtqplglryyhtdpdkgfflngkhlplhgvcrhqdraevgnalrpqhheedva lmremgvnairlahypqatymydlmdkhgivtwaeipfvgpggyadkgfvdqasfrengkqqlielirq hynhpsicfwglfnelkevgdnpveyvkelnalakqedptrpttsasnqdgnlnfiteniawnrydgwy gstpktlatfldrthkkhpelrigiseygagasiyhqqdslkqpsasgwwhpenwqtyyhmenwkiiae rpfvwgtfvwnmfdfgaahrtegdrpgindkglvtfdrkvrkdafyfykanwnkqepmiylaekrcrlr yqpeqtfmafttapeaelfvngvscgkqkadtystvvwknvkltsgeniirvttpgkkpltdevtveykedrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.186
    Matthews' coefficent 2.67 Rfactor 0.148
    Waters 528 Solvent Content 53.95

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3cmg
    1. Recent advances refining galactooligosaccharide production from lactose
    A Gosling, GW Stevens, AR Barber, SE Kentish - Food Chemistry, 2010 - Elsevier
     
    2. Crystal structures of Trichoderma reesei _-galactosidase reveal conformational changes in the active site
    M Maksimainen, N Hakulinen, JM Kallio - Journal of Structural , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch