.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cmn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative hydrolase with a novel fold from Chloroflexus aurantiacus. To be Published
    Site NYSGXRC
    PDB Id 3cmn Target Id NYSGXRC-10492m
    Molecular Characteristics
    Source Chloroflexus aurantiacus
    Alias Ids TPS8050,Q3E0L0_CHLAU Molecular Weight 44530.61 Da.
    Residues 391 Isoelectric Point 6.55
    Sequence lagnqndlrrfgtalllgvaagfaaryyletrarnstrpasglidweqarqaalrlsqweqapvdnraf rreqyarmvalsepliadylgvrlpepvsrifvfdrrewleanivsfsqlfrpieemyekngggrgalg vlmndvsskllgvqiggllgylaqrvlgqydlsllsaeatggslyfvepniarvqqqlglsdedfrlwi tlhemthafefeaypwvrtyfrelleqnfalvsgqmlssgnslvdmlmrllqgigsgqhwietvltpeq ravfdriqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrltgldlklaqyqq geafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrmdrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.289
    Matthews' coefficent 2.11 Rfactor 0.247
    Waters 76 Solvent Content 41.63

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch