.
The Open Protein Structure Annotation Network
PDB Keyword
.

3coi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of p38delta kinase. To be Published
    Site NYSGXRC
    PDB Id 3coi Target Id NYSGXRC-8325a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7763,PF00069, NP_002745 Molecular Weight 42087.46 Da.
    Residues 365 Isoelectric Point 8.48
    Sequence mslirkkgfykqdvnktawelpktyvspthvgsgaygsvcsaidkrsgekvaikklsrpfqseifakra yrellllkhmqhenviglldvftpasslrnfydfylvmpfmqtdlqkimgmefseekiqylvyqmlkgl kyihsagvvhrdlkpgnlavnedcelkildfglarhadaemtgyvvtrwyrapevilswmhynqtvdiw svgcimaemltgktlfkgkdyldqltqilkvtgvpgtefvqklndkaaksyiqslpqtprkdftqlfpr aspqaadllekmleldvdkrltaaqalthpffepfrdpeeeteaqqpfddslehekltvdewkqhiyke ivnfspiarkdsrrrsgmkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.09 Rfree 0.242
    Matthews' coefficent 2.85 Rfactor 0.208
    Waters 175 Solvent Content 56.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3coi
    1. The three-dimensional structure of MAP kinase p38: different features of the ATP-binding site in p38 compared with p38
    SB Patel, PM Cameron, SJ O'Keefe - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Homology modeling studies of yeast Mitogen-Activated Protein Kinases (MAPKS): structural motifs as a basis for specificity
    DL Smith, SH Nilar - Protein and Peptide Letters, 2010 - ingentaconnect.com
     
    3. p38 activation triggers dynamical changes in allosteric docking sites
    RG Rodriguez Limardo, DN Ferreiro, AE Roitberg - Biochemistry, 2011 - ACS Publications
     
    4. Analysis of conditions affecting auto-phosphorylation of human kinases during expression in bacteria
    A Shrestha, G Hamilton, E O'Neill, S Knapp - Protein expression and , 2011 - Elsevier
     
    5. Structural studies of MAP Kinase cascade components.
    EJ Goldsmith, X Min, H He, T Zhou - Methods in molecular biology (Clifton, , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch