.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cok

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PLK4 kinase. To be Published
    Site NYSGXRC
    PDB Id 3cok Target Id NYSGXRC-8389a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7764,PF00069, NP_055079 Molecular Weight 109079.32 Da.
    Residues 970 Isoelectric Point 8.80
    Sequence matcigekiedfkvgnllgkgsfagvyraesihsglevaikmidkkamykagmvqrvqnevkihcqlkh psilelynyfedsnyvylvlemchngemnrylknrvkpfsenearhfmhqiitgmlylhshgilhrdlt lsnllltrnmnikiadfglatqlkmphekhytlcgtpnyispeiatrsahglesdvwslgcmfytllig rppfdtdtvkntlnkvvladyemptflsieakdlihqllrrnpadrlslssvldhpfmsrnsstkskdl gtvedsidsghatistaitassstsisgslfdkrrlligqplpnkmtvfpknksstdfsssgdgnsfyt qwgnqetsnsgrgrviqdaeerphsrylrrayssdrsgtsnrqsqaktytmerchsaemlsvskrsggg eneerysptdnnanifnffkektssssgsferpdnnqalsnhlcpgktpfpfadptpqtetvqqwfgnl qinahlrktteydsispnrdfqghpdlqkdtsknawtdtkvkknsdasdnahsvkqqntmkymtalhsk peiiqqecvfgsdplseqsktrgmeppwgyqnrtlrsitsplvahrlkpirqktkkavvsildseevcv elvkeyasqeyvkevlqissdgntitiyypnggrgfpladrppsptdnisrysfdnlpekywrkyqyas rfvqllrskspkityftryakcilmenspgadfevwfydgvkihktedfiqviektgksytlksesevn slkeeikmymdhaneghriclalesiiseeerktrsapffpiiigrkpgstsspkalspppsvdsnypt rdrasfnrmvmhsdasptqapilnpsmvtneglgltttasgtdissnslkdclpksaqllksvfvknvg watqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyikqklqclssillmfsnptpnfh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.261
    Matthews' coefficent 2.15 Rfactor 0.211
    Waters 91 Solvent Content 42.66

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 2;SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3cok
    1. Analysis of conditions affecting auto-phosphorylation of human kinases during expression in bacteria
    A Shrestha, G Hamilton, E O'Neill, S Knapp - Protein expression and , 2011 - Elsevier
     
    2. Conserved Core Substructures in the Overlay of Protein-Ligand Complexes
    BC Finzel, R Akavaram, A Ragipindi - Journal of chemical , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch