.
The Open Protein Structure Annotation Network
PDB Keyword
.

3com

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mst1 kinase. To be Published
    Site NYSGXRC
    PDB Id 3com Target Id NYSGXRC-8191a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8057,PF00069, NP_006273.1 Molecular Weight 55627.35 Da.
    Residues 487 Isoelectric Point 4.97
    Sequence metvqlrnpprrqlkkldedsltkqpeevfdvleklgegsygsvykaihketgqivaikqvpvesdlqe iikeisimqqcdsphvvkyygsyfkntdlwivmeycgagsvsdiirlrnktltedeiatilqstlkgle ylhfmrkihrdikagnillnteghakladfgvagqltdtmakrntvigtpfwmapeviqeigyncvadi wslgitaiemaegkppyadihpmraifmiptnppptfrkpelwsdnftdfvkqclvkspeqratatqll qhpfvrsakgvsilrdlineamdvklkrqesqqrevdqddeenseedemdsgtmvravgdemgtvrvas tmtdgantmiehddtlpsqlgtmvinaedeeeegtmkrrdetmqpakpsfleyfeqkekenqinsfgks vpgplknssdwkipqdgdyeflkswtvedlqkrllaldpmmeqeieeirqkyqskrqpildaieakkrrqqnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.244
    Matthews' coefficent 3.05 Rfactor 0.208
    Waters 231 Solvent Content 59.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3com
    1. 7, 3_, 4_-Trihydroxyisoflavone, a metabolite of the soy isoflavone daidzein, suppresses ultraviolet B-induced skin cancer by targeting Cot and MKK4
    DE Lee, KW Lee, S Byun, SK Jung, N Song - Journal of Biological , 2011 - ASBMB
     
    2. Structural comparison of human mammalian ste20-like kinases
    CJ Record, A Chaikuad, P Rellos, S Das, ACW Pike - PloS one, 2010 - dx.plos.org
     
    3. Structures of human MST3 kinase in complex with adenine, ADP and Mn2+
    TP Ko, WY Jeng, CI Liu, MD Lai, CL Wu - Section D: Biological , 2010 - scripts.iucr.org
     
    4. Bioinformatics search for plant homologues of Ste20-like serine/threonine protein kinases
    PA Karpov, AI Emets, VG Matusov, AY Nyporko - Cytology and , 2009 - Springer
     
    5. Structural and functional insights into the TEAD-YAP complex in the Hippo signaling pathway
    L Chen, PG Loh, H Song - Protein & cell, 2010 - Springer
     
    6. Luteolin, a novel natural inhibitor of TPL2 kinase, inhibits tumor necrosis factor-_-induced cyclooxygenase-2 expression in JB6 mouse epidermis cells
    JE Kim, JE Son, YJ Jang, DE Lee, NJ Kang - of Pharmacology and , 2011 - ASPET
     
    7. Molecular basis for apoptotic Ras signalling through Nore1-MST1 multi-protein complex formation
    A Koturenkiene - 2008 - www-brs.ub.ruhr-uni-bochum.de
     
    8. Characterization of phosphorylation sites using 3D structural information
    A Del Bonifro - 2010 - tesi.cab.unipd.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch