.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cpg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an unknown protein from Bifidobacterium adolescentis. To be Published
    Site NYSGXRC
    PDB Id 3cpg Target Id NYSGXRC-11083b
    Molecular Characteristics
    Source Bifidobacterium adolescentis
    Alias Ids TPS7896,3.20.20.10, BAF40252.1 Molecular Weight 29031.41 Da.
    Residues 272 Isoelectric Point 5.56
    Sequence mtaymdhknlaneviddarareitdgvhrvldriaaaeeqagreagsvrllaatktrdigeimaaidag vrmigenrpqevtakaeglarrcaergfslgvagaapdaaaehipfhligqlqsnkigkvlpvvdties vdsidlaekisrravargitvgvllevnesgeesksgcdpahairiaqkigtldgielqglmtigahvh detvirrgfshlrktrdlilasgepgtdrcrelsmgmtgdmelaiaegstivrvgtaifgerafi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.71 Rfree 0.202
    Matthews' coefficent 1.99 Rfactor 0.175
    Waters 334 Solvent Content 38.07

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3cpg
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Overcoming sequence misalignments with weighted structural superposition
    NA Khazanov, KL Damm_Ganamet - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch