.
The Open Protein Structure Annotation Network
PDB Keyword
.

3crn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1. To be Published
    Site NYSGXRC
    PDB Id 3crn Target Id NYSGXRC-11024f
    Molecular Characteristics
    Source Methanospirillum hungatei
    Alias Ids TPS7890,3.40.50.2300, Q2FNF5_METHJ, PF00072 Molecular Weight 16145.69 Da.
    Residues 143 Isoelectric Point 4.61
    Sequence mkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdmegtellekahk lrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekldeqekdqivdgdkvaefleer llsir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.58 Rfree 0.22389
    Matthews' coefficent 2.13 Rfactor 0.18305
    Waters 180 Solvent Content 42.19

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 3crn
    1. Structure and regulatory mechanism of Aquifex aeolicus NtrC4: variability and evolution in bacterial transcriptional regulation
    JD Batchelor, M Doucleff, CJ Lee, K Matsubara - Journal of molecular , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch