.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ct2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Evolution of enzymatic activities in the enolase superfamily: stereochemically distinct mechanisms in two families of cis,cis-muconate lactonizing enzymes. Biochemistry 48 1445-1453 2009
    Site NYSGXRC
    PDB Id 3ct2 Target Id NYSGXRC-9450f
    Related PDB Ids 3dgb 3fj4 
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS7845,YP_260962 Molecular Weight 40916.57 Da.
    Residues 382 Isoelectric Point 6.09
    Sequence mhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygnespdsikt nidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlglpvsellggrvrdalpv awtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalgdsasvrvdvnqawdeav alracrilggngidlieqpisrnnragmvrlnasspapimadesiecvedafnlaregaasvfalkiak nggpratlrtaaiaeaagiglyggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvy rdfhlhvskapglglsldeerlaffrrdkttpvlhht
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.222
    Matthews' coefficent 2.33 Rfactor 0.215
    Waters 414 Solvent Content 47.30

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3ct2
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Evolution of Enzymatic Activities in the Enolase Superfamily: Stereochemically Distinct Mechanisms in Two Families of cis, cis-Muconate Lactonizing Enzymes
    A Sakai, AA Fedorov, EV Fedorov, AM Schnoes - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch