.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cta

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of riboflavin kinase from Thermoplasma acidophilum. To be Published
    Site NYSGXRC
    PDB Id 3cta Target Id NYSGXRC-10141b
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS7978,Q9HJA6, PF01982 Molecular Weight 24995.45 Da.
    Residues 220 Isoelectric Point 8.79
    Sequence metddqyyraikkikeaaeasnrayltsskladmlgisqqsasriiidlekngyitrtvtkrgqilnit ekgldvlytefadlsrilaiknnvvitgtvtsgmgegryyvarkqyiiqfqeklgiipylgtlnikvdq aslpelrkirgfrgihiegfktedrtfgsvkafpakiqnipcfvimpertvytdvieiisdkylreein lhdgdrvsvevyt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.270
    Matthews' coefficent 2.45 Rfactor 0.236
    Waters 52 Solvent Content 49.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cta
    1. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch