.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ctp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of periplasmic binding protein/LacI transcriptional regulator from Alkaliphilus metalliredigens QYMF complexed with L-xylulose. To be Published
    Site NYSGXRC
    PDB Id 3ctp Target Id NYSGXRC-11007h
    Molecular Characteristics
    Source Alkaliphilus metalliredigenes
    Alias Ids TPS7865,3.40.50.2300, PF00532, Q3CBC1_9CLOT Molecular Weight 37675.05 Da.
    Residues 333 Isoelectric Point 4.95
    Sequence manireiakragisiatvsrhlnntgyvsedarekiqkvvdelnytpnalaramftknsktiglmvpni snpffnqmasvieeyaknkgytlflcntdddkekektylevlqshrvagiiasrsqcedeyanidipvv afenhildniitissdnynggrmafdhlyekgcrkilhikgpevfeatelrykgfldgarakdleidfi efqhdfqvkmleedinsmkdivnydgifvfndiaaatvmralkkrgvsipqevqiigfdnsfigellyp slttinqpiealaytiiellikiingegvliedyimevklierettislkdldpasi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.41 Rfree 0.207
    Matthews' coefficent 1.91 Rfactor 0.182
    Waters 489 Solvent Content 35.61

    Ligand Information
    Ligands XLF (BETA-D-XYLULOFURANOSE) x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3ctp
    1. In-silico evidence of a pAO1 encoded pathway for the catabolism of tagatose derivatives in Arthrobacter nicotinovorans
    M Mih__an - Biologia, 2010 - Springer
     
    2. Crystal structure of TTHA0807, a CcpA regulator, from Thermus thermophilus HB8
    T Kumarevel, T Tanaka, A Shinkai - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch