The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a two component transcriptional regulator AraC from Clostridium phytofermentans ISDg. To be Published
    Site NYSGXRC
    PDB Id 3cu5 Target Id NYSGXRC-11009q
    Molecular Characteristics
    Source Clostridium phytofermentans
    Alias Ids TPS7870,, Q1FKY3_9CLOT, PF00072 Molecular Weight 61163.66 Da.
    Residues 531 Isoelectric Point 6.62
    Sequence mrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmprmdgielvdni lklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsiqtvlqhqaqqdsnvlyake avsrfaqrlthngydmksdtliddavlrgsinnstifttcilriispynvivdrsnlssylenfdkqia kwhlneihfikndslivlhiygnerpeesvvskigtyiksvipielnyfitfgktvtgpskvfdsynsa aillqssfffdygsilihksspqsvssiypheflndfteaireknflrarelvetlyrslknnktlltn vikdmyykaflqinsvqydlklqtenavsdsesmldnitnciilnelhqmllakidrfeeklqstpket stiflirdyisnhygdyslsikdisdhvrlsfsylctvfktetgetlnqyitnyriekakqllsdprnk iievssrvgyadnnyfgkifkkivgitpseyrekelgrntsfyvlkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.300
    Matthews' coefficent 2.34 Rfactor 0.183
    Waters 95 Solvent Content 47.40

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch