.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cwv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of B-subunit of the DNA gyrase from Myxococcus xanthus. To be published
    Site NYSGXRC
    PDB Id 3cwv Target Id NYSGXRC-11001l
    Molecular Characteristics
    Source Myxococcus xanthus
    Alias Ids TPS7855,Q1CZR7_MYXXD, 3.30.565.10 Molecular Weight 39539.29 Da.
    Residues 361 Isoelectric Point 7.21
    Sequence mlgmhlpggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfcts rtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmgehghpqgegaav tpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapglrvsfadlqrgertlwhlpgg vaqwahvltearpqlhpepvvfdftwdglrvqcalqwcededstllsfanavrtvrhgahvkgvtqalr galaklsgetrgafpwarvaqgltaivavsgprrqmafagptkellaipgleeairkqlqplfiellre hpvtpallarrtsgsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.247
    Matthews' coefficent 2.72 Rfactor 0.209
    Waters 345 Solvent Content 54.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cwv
    1. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch