.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Methanothermobacter thermautotrophicus. To be Published
    Site NYSGXRC
    PDB Id 3cxj Target Id NYSGXRC-10518a
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS8054,O27461_METTH Molecular Weight 18300.02 Da.
    Residues 155 Isoelectric Point 5.01
    Sequence msqemikkwldeegflrmevpdenarfhyvvnypedhvidiiqpagkddmiliacatsvspehqagira lsmekrtefiwkvrftlnrfgvdfqldhpenvlnsylvtdeiffdglskdrlissiknvfraklqvmwm iqerfgeerpehdsmyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.31
    Matthews' coefficent 2.63 Rfactor 0.252
    Waters 122 Solvent Content 53.31

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch