.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1. To be Published
    Site NYSGXRC
    PDB Id 3cyg Target Id NYSGXRC-10495j
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS8052,A0HNP4_9THEM Molecular Weight 29146.10 Da.
    Residues 247 Isoelectric Point 5.20
    Sequence lrkvddfmekfsetrsrifmigvlmlisllvvfyisrmkvfeivkssteneivrihvelprlkylkdsn feekfnseveekikkfvnevkgiaqedhdkdvqhtpyeayvsvdvryegkdflsfvvyyyqftggahgi tffetynidlknskvlklydiikeeaedtiksnilkqieqnntdffpdapmnilkddifsreftiskdg liimyphydlapyasgmpefvipwnviekflkydilsllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.61 Rfree 0.299
    Matthews' coefficent 2.41 Rfactor 0.244
    Waters 69 Solvent Content 49.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cyg
    1. The third pillar of bacterial signal transduction: classification of the extracytoplasmic function (ECF) _ factor protein family
    A Staro_, HJ Sofia, S Dietrich, LE Ulrich - Molecular , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch