.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cyj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from Rubrobacter xylanophilus. To be Published
    Site NYSGXRC
    PDB Id 3cyj Target Id NYSGXRC-9282f
    Molecular Characteristics
    Source Rubrobacter xylanophilus
    Alias Ids TPS7806,PF02746 Molecular Weight 38792.76 Da.
    Residues 362 Isoelectric Point 5.57
    Sequence msgprverlevsaytvptdypesdgtlqwdsttmilveahgggrkglgytygdvsvgrfvesklagvae gsdalsppavwarmqaairnagrpgvgamavsavdialwdlkarllglpladalprfhaevpvygsggf tsyplrrlqeqlggwaaagiprvkmkvgrepekdpervraareaigesvelmvdangaytrkqalywag afareagisyleepvssedreglrllrdrgpggvaiaageyewtlpqlhdlagcvdilqadvtrcggit gllrvdgicrghqipfsahcapavsahaccavesllhleyfhdharverllfdgtldpeggslrpdpdr pglglelkrseagkyaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.292
    Matthews' coefficent 3.30 Rfactor 0.243
    Waters 512 Solvent Content 62.74

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3cyj
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch