.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cz5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of two-component response regulator, LuxR family, from Aurantimonas sp. SI85-9A1. To be Published
    Site NYSGXRC
    PDB Id 3cz5 Target Id NYSGXRC-11008w
    Molecular Characteristics
    Source Aurantimonas sp.
    Alias Ids TPS7867,Q1YEP2_9RHIZ, 3.40.50.2300, PF00072 Molecular Weight 23094.12 Da.
    Residues 212 Isoelectric Point 5.99
    Sequence mstarimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpgpggieatr hirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieailagrramspdiaqeiaee rvegrataiadlspreteilrmlasgmtsdeiaaglclsvktvqnnhyqikaklgartdahlvwvaiea glvrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.275
    Matthews' coefficent 2.72 Rfactor 0.196
    Waters 69 Solvent Content 54.78

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch