.
The Open Protein Structure Annotation Network
PDB Keyword
.

3czb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transglycosylase from Caulobacter crescentus. To be Published
    Site NYSGXRC
    PDB Id 3czb Target Id NYSGXRC-10110d
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS7967,PF03562, Q9A226 Molecular Weight 41144.60 Da.
    Residues 395 Isoelectric Point 6.98
    Sequence mtrlaytslaplalaavlsacastpattpppaavsaptpapappsvqapvasapqsampaalsfaglag waeedhlaalnafragcgvskdpaaarvcglakatkdldvsgakafieanfrveavdgggdglltayfa pqyearmsrnaefsaplrglpadlvvldlgpfepalvgkkitghvegstfvpypdraeieatpsdkpla wmrpeelfflqiqgsgvlvlpdgrrvravfagtngkpfvgiaiamrdkgllpdnntsadairtwlaehr gpeadaimrlnpryvffrtvpddgkepagaagvalppgraiavdpgyhayggfywldaaapklvgafpv yrravtaldtggaikgevradlymgsgavagveagrvrhtlrlyrltpnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.250
    Matthews' coefficent 2.88 Rfactor 0.199
    Waters 164 Solvent Content 57.31

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 3czb
    1. Structure-based functional annotation of protein sequences guided by comparative models
    DM Standley, AR Kinjo, M Lis - on Optimization and , 2008 - aporc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch