.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d0c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dihydrodipicolinate synthase from Oceanobacillus iheyensis at 1.9 A resolution. To be Published
    Site NYSGXRC
    PDB Id 3d0c Target Id NYSGXRC-9375o
    Molecular Characteristics
    Source Oceanobacillus iheyensis
    Alias Ids TPS7830,23100300, PF000701 Molecular Weight 33695.41 Da.
    Residues 304 Isoelectric Point 4.69
    Sequence mdygefskrfstisginivpflegtreidwkglddnvefllqngievivpngntgefyaltieeakqva trvtelvngratvvagigysvdtaielgksaidsgadcvmihqpvhpyitdagaveyyrniiealdaps iiyfkdahlsddvikelapldklvgikyaindiqrvtqviravpkssnvaficgtaekwapffyhagav gftsglvnvfpqksfallealeegnqekiwdvwedvvpfedlrakhnngnnvviikeameqlglragvt repvnplspndrleleellkswntqevr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.243
    Matthews' coefficent 2.28 Rfactor 0.218
    Waters 442 Solvent Content 45.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d0c
    1. An antibiotic-resistance enzyme from a deep-sea bacterium
    M Toth, C Smith, H Frase, S Mobashery - Journal of the , 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch