.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d19

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved metalloprotein from Bacillus cereus. To be Published
    Site NYSGXRC
    PDB Id 3d19 Target Id NYSGXRC-10509b
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8053,Q4MW04_BACCE Molecular Weight 33269.29 Da.
    Residues 283 Isoelectric Point 5.90
    Sequence mhrdetslhpdtgvtsvmfverslneirfwsrimkehslflrlgfrcedtqlieeanqfyrlfehieqi ahsytnetdpeqikrfnaevqqaatniwgfkrkilgliltcklpgqnnfpllvdhtsreadyfrkrlme lnegkldalpdaiikenvfflrimadhakfighlldpserklvdtarnfsndfdalmyqaidlesmkpq sqtvplldqfldqnrvsvaslrdfkktardlieqckiksiihplladhvfreadrfleiidmydvhltn iqsqpry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.268
    Matthews' coefficent 2.17 Rfactor 0.206
    Waters 129 Solvent Content 43.19

    Ligand Information
    Ligands
    Metals FE (FE) x 6;MG (MAGNESIUM) x 6

    Jmol

     
    Google Scholar output for 3d19
    1. Identification of two-histidines one-carboxylate binding motifs in proteins amenable to facial coordination to metals
    B Amrein, M Schmid, G Collet, P Cuniasse, F Gilardoni - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch