.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a beta-galactosidase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3d3a Target Id NYSGXRC-11092f
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS7898,AAO75397.1, 3.20.20.80 Molecular Weight 88745.75 Da.
    Residues 779 Isoelectric Point 5.44
    Sequence mkkpllyllilvvavlgsscsqssegtfevgkntfllngepfvvkaaeihypripkeywehrikmckal gmnticlyvfwnfhepeegrydfagqkdiaafcrlaqengmyvivrpgpyvcaewemgglpwwllkkkd iklreqdpyymervklflnevgkqladlqiskggniimvqveneygafgidkpyiseirdmvkqagftg vplfqcdwnsnfennalddllwtinfgtganideqfkrlkelrpdtplmcsefwsgwfdhwgakhetrs aeelvkgmkemldrnisfslymthggtsfghwgganfpnfsptctsydydapinesgkvtpkylevrnl lgnylpegetlpeipdsiptiaiptikmtemavlfdnlphpkesedirtmeafdqgwgsilyrtslsas dkeqtlliteahdwaqvflngkklatlsrlkgegvvklpplkegdrldilveamgrmnfgkgiydwkgi tekvelqsdkgvelvkdwqvytipvdysfardkqykqqenaenqpayyrstfnlnelgdtflnmmnwsk gmvwvnghaigryweigpqqtlyvpgcwlkkgeneiiildmagpskaeteglrqpildvqrgngayahr kmgenldltnetpvyqgifksgngwqhvkfgkkvetrffclealnahdgkdfaaiaelellgedgkpvs rqhwkviyadseetdaanniatnvfdlqestfwhtnyssskpafphqividlgedkvitgfsylpraea gktgmikdykvylkmqpfki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.254
    Matthews' coefficent 2.87 Rfactor 0.214
    Waters 384 Solvent Content 57.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d3a
    1. Recent advances refining galactooligosaccharide production from lactose
    A Gosling, GW Stevens, AR Barber, SE Kentish - Food Chemistry, 2010 - Elsevier
     
    2. Crystal structures of Trichoderma reesei _-galactosidase reveal conformational changes in the active site
    M Maksimainen, N Hakulinen, JM Kallio - Journal of Structural , 2011 - Elsevier
     
    3. GM1 gangliosidosis and Morquio B disease: An update on genetic alterations and clinical findings
    A Caciotti, SC Garman, Y Rivera-Coln - et Biophysica Acta (BBA , 2011 - Elsevier
     
    4. Structural bases of GM1 gangliosidosis and Morquio B disease
    M Morita, S Saito, K Ikeda, K Ohno - Journal of human , 2009 - nature.com
     
    5. Crystal Structure of Human _-Galactosidase
    U Ohto, K Usui, T Ochi, K Yuki, Y Satow - Journal of Biological , 2012 - ASBMB
     
    6. Crystallization and preliminary diffraction analysis of a-galactosidase from Trichoderma reesei
    M Maksimainen, T Timoharju, JM Kallio - Section F: Structural , 2009 - scripts.iucr.org
     
    7. Structural Insights into the Substrate Specificity of Streptococcus pneumoniae _ (1, 3)-Galactosidase BgaC
    W Cheng, L Wang, YL Jiang, XH Bai, J Chu, Q Li - Journal of Biological , 2012 - ASBMB
     
    8. Gangliosidose GM1: aspectos clnicos e moleculares da populao brasileira ea busca de novas terapias para o tratamento da doena
    FS Ludwig - 2012 - repositorioceme.ufrgs.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch