.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d5l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DNA repair regulatory protein RecX. To be Published
    Site NYSGXRC
    PDB Id 3d5l Target Id NYSGXRC-10123k
    Molecular Characteristics
    Source Lactobacillus reuteri
    Alias Ids TPS7976,Q1U8Q6, PF02631 Molecular Weight 30948.75 Da.
    Residues 264 Isoelectric Point 9.07
    Sequence makiskieaqkrkgryniyldgkyafpvaesvliqfrlmkgteldekqiaaiatadqqakaysrmldyl syqmrtesdivkklkeidtpeefvepilkklrgqqliddhayaasyvrtmintdlkgpgiirqhlrqkg igesdiddaltqftpevqaelakklalklfrryrnqperrreqkvqqglttkgfsssvyemikdevvpq pdleqendllakeaakqwrrvrryqgyereqhfkqtmyrkgfdlddvqswldaqdfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.300
    Matthews' coefficent 2.71 Rfactor 0.246
    Waters 92 Solvent Content 54.68

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d5l
    1. Molecular Structure of a Peroxisomal Matrix Protein Transport Factor, Pex14p
    ____ _____ _____ _____ ____ - _______, 2009 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch