The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crsytal structure of a phosphatase from a toxoplasma gondii. To be Published
    Site NYSGXRC
    PDB Id 3d8k Target Id NYSGXRC-9110a
    Molecular Characteristics
    Source Toxoplasma gondii
    Alias Ids TPS7929,PF00481, ABO31335.1 Molecular Weight 48352.65 Da.
    Residues 445 Isoelectric Point 9.40
    Sequence maslrvlalaclplfavlhadaktllgkvkratgmgvgegpsvakkpkytatvpgftppsgdqrmnefm avdtsgefmrhlyieegrtvcasatsrnrrptsesphsddvvvvegmlrgrpetrvhamfdgfqgrhsa mwlaqnvmnylndlrdvneeeitrqfermdgdlraanlpggssaliifvryekkptearvvgrqivpeg akeftsvaealggplmpvvamnfrrdpraakgiytihvaslgnsrcvlksgrtaihlstphtasshker hrvqaaggvfttvngelllggvvpmtrafgsfdfkkggqgklqqdlvsavpdvttffaypgddivagta gafahfrshaaiaaaialypvspetvldaakamvvnakrrkvtknistfvrhlpesrtrsqkmlegtsg engeedfsidrtneltqalqagffsfllyyp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.71 Rfree 0.304
    Matthews' coefficent 2.45 Rfactor 0.251
    Waters 181 Solvent Content 49.85

    Ligand Information
    Ligands SO4 (SULFATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch