.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dbi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Sugar-Binding Transcriptional Regulator (LacI Family) from Escherichia Coli Complexed with Phosphate. To be Published
    Site NYSGXRC
    PDB Id 3dbi Target Id NYSGXRC-11030h
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7893,3.40.50.2300, PF00532, ASCG_ECOLI Molecular Weight 36939.53 Da.
    Residues 335 Isoelectric Point 7.80
    Sequence mmttmlevakragvskatvsrvlsgngyvsqetkdrvfqaveesgyrpnllarnlsakstqtlglvvtn tlyhgiyfsellfhaarmaeekgrqllladgkhsaeeerqaiqylldlrcdaimiyprflsvdeiddii dahsqpimvlnrrlrknsshsvwcdhkqtsfnavaelinaghqeiafltgsmdsptsierlagykdala smvlrsmknlsltvngrlpagrrvemllergakfsalvasnddmaigamkalhergvavpeqvsvigfd diaiapytvpalssvkipvtemiqeiigrlifmldggdfspktfsgklirrdsliapsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.45 Rfree 0.27042
    Matthews' coefficent 2.55 Rfactor 0.23091
    Waters 119 Solvent Content 51.72

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3dbi
    1. Mass spectrometry guided in situ proteolysis to obtain crystals for X-ray structure determination
    T Gheyi, L Rodgers, R Romero, JM Sauder - Journal of the American , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch