.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ddm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME FROM Bordetella bronchiseptica RB50. To be Published
    Site NYSGXRC
    PDB Id 3ddm Target Id NYSGXRC-9284b
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS9404,PF01188, 33601439 Molecular Weight 39989.36 Da.
    Residues 382 Isoelectric Point 6.09
    Sequence mtrdaasitparvrahvfrypvstpvktsfgtmhdrpavlvevedsdgavgwgevwcnfpacgaehrar lvetvlaplltarafadpaqafahleartavlaiqtgepgplaqaiagldialcdlaarragqplwawl ggsgdrigvyasginpenpedvvarkaaegyrafklkvgfddardvrnalhvrellgaatplmadanqg wdlprarqmaqrlgpaqldwleeplradrpaaewaelaqaapmplaggeniagvaafetalaarslrvm qpdlakwggfsgclpvaravvaaglrycphylgagiglqasahllaavpglaspgllevdandnplrsl lspalatlhegritlggapglgvtpdlaalraacaar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.258
    Matthews' coefficent 3.75 Rfactor 0.224
    Waters 74 Solvent Content 67.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ddm
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. On the membrane-bound rotor of chloroplast ATP synthase
    BD Varco-Merth - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch