.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dec

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Glycosyl Hydrolases Family 2 protein from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3dec Target Id NYSGXRC-12014d
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS26962,NP_812091.1, PF02836 Molecular Weight 116734.05 Da.
    Residues 1024 Isoelectric Point 6.17
    Sequence mikmnnllkpfflmmlaapaiisttaqqqqpewqsqyavglnkldphtyvwpyadasevekgtfeqspy ymslngqwkfhwvknpdtrpkdfykpsyytggwadikvpgnwerqgygtaiyvnetyefddkmfnfkkn pplvpykenevgsyrrtfkvpagwegrrvvlccegvisfyyvwvngeflgynqgsktaaewditdkltd gentialevyrwssgaylecqdmwrlsgierdvylystpeqyiadykvtsllekehykegifelevavg gtasgtssiaytlkdasdktvlegsrkleshgsgnlivfdeqrlpdvrrwnaehpelytlllelkdagg kvteitgtkvgfrtseikngrfcingvpvlvkgvnrhehsqlgrtvskelmeqdirlmkqhnintvrns hypahpywyqlcdryglyvideanieshgmgygpaslakdstwlpahidrtrrmyersknhpsvviwsl gneagnginfertydwlksveknrpvqyeraeenyntdiycrmyrsvdvirnyvarkdiyrpfilceyl hamgnscggmkeywevfenepmaqggciwdwvdqsfrevdkdgkwywtyggdygpkdvpsfgnfccngl vnavrephphllevkkiyqnikstlidkknltvrvknwfdfsdlneyilhwkvtgddgtvlaegnkeva cephatveltlgavqlpktireayldlgwtrkkstplvdtaweiaydqfvlpasgkvwngkpseagktt fevdentgalkslcldgeellaspvtislfrpatdndnrdrmgaklwrkaglhtltqkvvslkesktsa taqvnilnvtgkkvgdatleytlnhngslkvqttfqpdttwvksiarlgltfemndtygnvtylgrgeh etyidrnqsgkigiytttpekmfhyyvipqstgnrtdvrwvkladdsgkgcwiesdspfqfsalpfsdl llekalhindlerngritvhldakqagvgtatcgpgvlppylvplgkqtftftiypvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.24312
    Matthews' coefficent 2.62 Rfactor 0.18406
    Waters 98 Solvent Content 52.97

    Ligand Information
    Ligands
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 3dec
    1. Nano-structure of the laminin [gamma]-1 short arm reveals an extended and curved multidomain assembly
    TR Patel, GA Morris, D Zwolanek, DR Keene, J Li - Matrix Biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch