.
The Open Protein Structure Annotation Network
PDB Keyword
.

3df7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3df7 Target Id NYSGXRC-10040d
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS9410,PF02655, O29201 Molecular Weight 33775.70 Da.
    Residues 304 Isoelectric Point 4.80
    Sequence mklflfefatcgeriedstaveglamfksafdgfknyyeitgfvrpefsclftlpvdsmdsmekyleks dafliiapeddfllytltkkaekycenlgsssraiavtsdkwelykklrgevqvpqtslrpldckfiik prtacagegigfsdevpdghiaqefieginlsvslavgedvkclsvneqiinnfryagavvparisdev krevveeavravecveglngyvgvdivysdqpyvieinarlttpvvafsraygasvadllaggevkhvr rqmvrksksaekpyvsvgdytleiidld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.87 Rfree 0.226
    Matthews' coefficent 2.20 Rfactor 0.186
    Waters 347 Solvent Content 44.16

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch