.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dfh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title crystal structure of putative mandelate racemase / muconate lactonizing enzyme from Vibrionales bacterium SWAT-3. To be Published
    Site NYSGXRC
    PDB Id 3dfh Target Id NYSGXRC-9459a
    Molecular Characteristics
    Source Vibrionales bacterium swat-3
    Alias Ids TPS9405,145965884, PF01188 Molecular Weight 45119.00 Da.
    Residues 399 Isoelectric Point 5.72
    Sequence vketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpiligknannied lwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrdaipvythatsdtmegiydl vegflekgykhircqlgfyggvptdlhttqnptegsyydqdqymdntltmfkslrekygnqfhilhdvh erlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqssvslglgelfnnpeewkslianrridf irchvsqiggitpalklghlcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkv fpnaaepingylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.234
    Matthews' coefficent 2.21 Rfactor 0.173
    Waters 375 Solvent Content 44.29

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch