.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dh0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus. To be Published
    Site NYSGXRC
    PDB Id 3dh0 Target Id NYSGXRC-11116c
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9408,NP_214005.1, 3.40.50.150 Molecular Weight 24017.77 Da.
    Residues 210 Isoelectric Point 5.05
    Sequence mahkfdpskikklddpsrlelfdpekvlkefglkegmtvldvgtgagfylpylskmvgekgkvyaidvq eemvnyawekvnklglknvevlkseenkiplpdntvdfifmaftfhelseplkfleelkrvakpfayla iidwkkeerdkgpppeevysewevgliledagirvgrvvevgkycfgvyamivkqeeenplmnvpfkip pgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.72 Rfree 0.296
    Matthews' coefficent 2.29 Rfactor 0.231
    Waters 47 Solvent Content 46.19

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3dh0
    1. AS_adenosylmethionine methyltransferase_like domain within the essential, Fe_S_containing yeast protein Dre2
    N Soler, CT Craescu, J Gallay, YM Frapart - FEBS , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch