.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dhu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an alpha-amylase from Lactobacillus plantarum. To be Published
    Site NYSGXRC
    PDB Id 3dhu Target Id NYSGXRC-11098h
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS9406,CAD62849.1, 3.20.20.80 Molecular Weight 49912.77 Da.
    Residues 440 Isoelectric Point 4.89
    Sequence mardtqtqlrnemiysvfvrnyseagnfagvtadlqrikdlgtdilwllpinpigevnrkgtlgspyai kdyrginpeygtladfkaltdrahelgmkvmldivynhtspdsvlatehpewfyhdadgqltnkvgdws dvkdldyghhelwqyqidtllywsqfvdgyrcdvaplvpldfwlearkqvnakypetlwlaesagsgfi eelrsqgytglsdselyqafdmtydydvfgdfkdywqgrstveryvdllqrqdatfpgnyvkmrflenh dnarmmslmhskaeavnnltwifmqrgipliyngqeflaehqpslfdrdtmvadrhgdvtpliqklvti kqlpllraadyqlavveegivkityraagealtawiplkgqvtavatklaagsyqnlltdgptevvdgk ltvdgqpvlikyvtntavtkvadqsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.251
    Matthews' coefficent 2.39 Rfactor 0.200
    Waters 1331 Solvent Content 48.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch