.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dip

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an enolase protein from the environmental genome shotgun sequencing of the Sargasso Sea. To be Published
    Site NYSGXRC
    PDB Id 3dip Target Id NYSGXRC-9253d
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS9403,PF01188 Molecular Weight 42927.75 Da.
    Residues 401 Isoelectric Point 5.82
    Sequence mpritalrtirlperpkliwvevetedgltglgetfrgaqaveavlheqtapaiigraaenitsissel lnpyvgfgsssaevraasavdialwdlagqragvplhvalggaardrvpvyatcagydfntslggrrsi gsaelstgpyddqvafmrdagvlaeslvaegyaamkiwpfddfasitphhisltdlkdglepfrkiraa vgqrieimcelhslwgthaaaricnaladygvlwvedpiakmdnipavadlrrqtrapicggenlagtr rfhemlcadaidfvmldltwcgglsegrkiaalaetharplaphdctgpvalmaglhlalhaptaifqe vvraslatwyadlvdhlpviqegialaptrpglgtallphvrkiagavvresgkpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 2.65 Rfactor 0.215
    Waters 231 Solvent Content 53.62

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3dip
    1. Indexing and Retrieval of Multiple 3D Protein Structure Representations for the Protein Data Bank
    E Paquet, HL Viktor - 2009 - nparc.cisti-icist.nrc-cnrc.gc.ca
     
    2. Modulation du statut redox endogne comme vecteur de la radiosensibilisation de tumeurs suite l'irradiation par Rayons X et ions Carbone.
    M HANOT, C MALESYS, A BOIVIN, N FORAY - 15mes Journes d' , 2010 - iramis.cea.fr
     
    3. Data mining techniques for enhancing protein function prediction
    G Pandey - 2010 - conservancy.umn.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch