.
The Open Protein Structure Annotation Network
PDB Keyword
.

3djc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pantothenate Kinase from Legionella Pneumophila. To be Published
    Site NYSGXRC
    PDB Id 3djc Target Id NYSGXRC-10117d
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS9411,PF03309, Q5WXZ6 Molecular Weight 27742.55 Da.
    Residues 256 Isoelectric Point 8.48
    Sequence milcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirkiaicsvvpqvd yslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaathsfpnqniividfgtattfca ishkkaylggailpglrlsadalskntaklpsveiiktesvvgrstiesiqsgvyygvlgackeliqri hheafngdkililatggfaslfdkqglydhlvpdlvlqgirlaammnta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.40 Rfree 0.313
    Matthews' coefficent 2.48 Rfactor 0.259
    Waters 285 Solvent Content 50.41

    Ligand Information
    Ligands GOL (GLYCEROL) x 11
    Metals

    Jmol

     
    Google Scholar output for 3djc
    1. Structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae
    K Michalska, ME Cuff, C Tesar, B Feldmann - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch