.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dli

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SAM dependent methyltransferase from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3dli Target Id NYSGXRC-11116b
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS9407,NP_068887.1, 3.40.50.150 Molecular Weight 55343.92 Da.
    Residues 473 Isoelectric Point 8.20
    Sequence mekrqfmkmkeklkracfefavsnrylynlakrildsspklqkikeflipkeflipaanlsnvfepets fqnsgrffkkiktcfngglppenldqdlaiinqrwnvnnegyqifshrkilgpflvrgrrlvhgevrry vdpifhlqrefnasvvrilnrttedlrvlsskndaiegklntveekisgtvrkdefkefkdkiminhdk lqtdfyelknsltknleelsstvesikakidtaeekisgtdihtsdyyflfeekfrgsrelvkarlrry ipyfkgcrrvldigcgrgeflelckeegiesigvdinedmikfcegkfnvvksdaieylkslpdkyldg vmishfvehldperlfellslcyskmkyssyiviespnptslyslinfyidpthkkpvhpetlkfiley lgfrdvkieffeeceeltklakidsntvseevirvinenieklnrilfgpqdyaiiakk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.46 Rfree 0.286
    Matthews' coefficent 2.24 Rfactor 0.23
    Waters 157 Solvent Content 45.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dli
    1. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     
    2. Architectures, mechanisms and molecular evolution of natural product methyltransferases
    DK Liscombe, GV Louie, JP Noel - Natural Product Reports, 2012 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch